Search results for " fo"

showing 10 items of 22510 documents

La “forza del diritto”: attori, retoriche e campi sociali nella battaglia simbolica per la definizione del fenomeno mafioso

2021

L’articolo affronta il tema dei rapporti di forza tra vari “campi sociali” (Bourdieu 2009, 2017) e tra varie discipline (Foucault 1971, 1974) nella battaglia simbolica per la definizione del fenomeno mafioso, indagando su quanto (e come) la definizione fornita in sede legislativa (tradotta in fattispecie penale nell’articolo 416bis) e/o applicata nella prassi giudiziaria, si avvalga del contributo di altre dottrine e in che modo istanze, retoriche e metodi di differenti saperi esperti (sociologia, storia, psicologia, economia, etc.) vengano “tradotte” (più o meno consapevolmente) nelle logiche del campo giuridico. Riconoscendo il valore performativo della legge (Derrida 2003) e la dimension…

"campo giuridico" associazione a delinquere di stampo mafioso processi di mafia imprenditori morali forza simbolicaSettore SPS/12 - Sociologia Giuridica Della Devianza E Mutamento Sociale“juridical field” Mafia-type criminal association Mafia trials moral entrepreneurs symbolic force
researchProduct

Kulinaria w przestrzeni miasta : nowe trendy, nowe potrzeby mieszkańców

2015

The subject of this article is culinary trends observable in Polish cities during the past few years. They include both the rediscovered practices, directly related to the cultural (culinary) heritage of a particular area, and these which have become popular only recently. According to the author, characteristic culinary fads are: the promotion of local delicacies on a large scale, growing interest in shopping in farmers’ markets offering organic produce (bio-markets) and traditional goods, growing popularity of street food (including street food festivals and picnics), and organizing the so called “breakfast on the grass” events.

"śniadanie na trawie"citykulinariastreet foodculinaryprodukty tradycyjne“breakfast on the grass”traditional productsmiastoStudia Etnologiczne i Antropologiczne
researchProduct

Photocatalytic and Catalytic Oxidation of 2-Propanol over Au/TiO2-CeO2 Catalysts

2016

Photocatalytic and catalytic oxidation of 2-propanol (representative VOC’s compound) were compared over mixed (Au)TiO2-CeO2-based catalysts. The role of support in Au catalyzed oxidation reaction under photo and dark conditions was studied. In the photocatalytic oxidation CeO2 had a negative effect on the performance towards the alcohol conversion of both TiO2-CeO2 and Au/TiO2-CeO2 catalysts, being Au/TiO2 the most active system. On the contrary mixed TiO2-CeO2 and Au/TiO2- CeO2 samples showed a higher catalytic oxidation efficiency for 2-propanol conversion compared to the single oxides.

(Au)TiO2-CeO2-based catalysts photocatalytic oxidation catalytic oxidationSettore CHIM/07 - Fondamenti Chimici Delle Tecnologie
researchProduct

Validez y reproducibilidad de una rúbrica para el análisis de la expresividad en la danza

2022

La danza es una disciplina artística que combina la destreza del movimiento corporal con la expresividad de emociones, sentimientos e ideas. Sin embargo, generalmente la expresividad queda en segundo plano tanto en el proceso de enseñanza como en su evaluación. En ese sentido, el objetivo del presente estudio fue diseñar y validar una rúbrica para evaluar la expresividad en la danza en general, así como valorar su reproducibilidad inter-evaluador y su aplicación en dos grupos de bailarines/as. Ambos grupos se aprendieron una misma coreografía con la diferencia de que solo uno de ellos fue conocedor de la rúbrica. Dicha coreografía fue grabada en vídeo para posteriormente ser evaluada por do…

-- FormacióAvaluació educativaDansaArt
researchProduct

GPS izsekošanas sistēmas funkcionalitātes uzlabojumi

2021

Kvalifikācijas darba ietvaros ir izstrādāt “Degvielas atskaites” programmatūru, ar kuras palīdzību atvieglotu darbu grāmatvežiem un ietaupītu viņu laiku, uzskaitot uzņēmuma tehnikas degvielas lietošanu. Programmatūra ļauj lietotājiem pievienot jaunus degvielas čekus, tos skatīt, rediģēt, kā arī dzēst. Programmprodukta mērķis ir degvielas čeku ievietošana datu bāzē un to datu ģenerēšana atskaites veidā. Funkcionalitātes uzlabojumi tika izstrādāti C# valodā, izmantojot Microsoft .NET satvaru un tajā esošo Windows Forms bibliotēku, Microsoft RDLC Report Designer .NET ietvaru, kā arī SQL Server Express datubāzi.

.NETDatorzinātneGPSC#Windows FormsExcel
researchProduct

Hard cap espresso extraction and liquid chromatography determination of bioactive compounds in vegetables and spices

2017

Abstract A new analytical procedure, based on liquid chromatography with diode array and fluorescence detection, has been proposed for the determination of bioactive compounds in vegetables and spices after hard cap espresso extraction. This novel extraction system has been tested for the determination of capsaicin and dihydrocapsaicin from fresh chilli and sweet pepper, piperine from ground pepper, curcumin from turmeric and curry, and myristicin from nutmeg. Extraction efficiency was evaluated by using acetonitrile:water and ethanol:water mixtures. The proposed method allows the extraction of samples with 100 mL of 60% (v/v) ethanol in water. The obtained limits of quantification for the …

01 natural sciencesMyristicaAnalytical ChemistryDihydrocapsaicinchemistry.chemical_compoundEspresso0404 agricultural biotechnologyVegetablesPepperSpicesChromatographybiologyChemistry010401 analytical chemistryExtraction (chemistry)Nutmeg04 agricultural and veterinary sciencesGeneral Medicinebiology.organism_classification040401 food scienceDiode array0104 chemical sciencesMyristicinPiperineCapsicumChromatography LiquidFood ScienceFood Chemistry
researchProduct

Discrete spectral incoherent solitons in nonlinear media with noninstantaneous response

2011

International audience; We show theoretically that nonlinear optical media characterized by a finite response time may support the existence of discrete spectral incoherent solitons. The structure of the soliton consists of three incoherent spectral bands that propagate in frequency space toward the low-frequency components in a discrete fashion and with a constant velocity. Discrete spectral incoherent solitons do not exhibit a confinement in the space-time domain, but exclusively in the frequency domain. The kinetic theory describes in detail all the essential properties of discrete spectral incoherent solitons: A quantitative agreement has been obtained between simulations of the kinetic…

01 natural sciencesoptical instabilitiesSchrödinger equation010309 opticssymbols.namesakeand lossesQuantum mechanics0103 physical sciencesDispersion (optics)Dynamics of nonlinear optical systemsOptical solitonssolitons010306 general physicsPropagationNonlinear Schrödinger equationNonlinear Sciences::Pattern Formation and SolitonsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]and optical spatio-temporal dynamicsscatteringWave equationAtomic and Molecular Physics and OpticsSupercontinuumNonlinear systemFrequency domainsymbolsoptical chaos and complexitySolitonnonlinear guided waves
researchProduct

On Whitham and Related Equations

2017

The aim of this paper is to study, via theoretical analysis and numerical simulations, the dynamics of Whitham and related equations. In particular, we establish rigorous bounds between solutions of the Whitham and Korteweg–de Vries equations and provide some insights into the dynamics of the Whitham equation in different regimes, some of them being outside the range of validity of the Whitham equation as a water waves model.

010101 applied mathematicsPhysicsRange (mathematics)Nonlinear Sciences::Exactly Solvable and Integrable SystemsWhitham equationApplied Mathematics010102 general mathematicsMathematical analysis0101 mathematicsNonlinear Sciences::Pattern Formation and Solitons01 natural sciencesStudies in Applied Mathematics
researchProduct

Optimum Design and Performance of an Electron Gun for a Ka-Band TWT

2019

This paper deals with optimum design and development of a thermionic electron gun to meet specified beam requirements within defined electric and geometric constraints for a Ka -band traveling wave tube (TWT) for space applications. The electron gun design is based on the Pierce method and carried out according to the iterative process indicated by Vaughan. The design of a periodic permanent magnet (PPM) beam focusing system for the stability of the beam is also required. A sensitivity analysis, by varying electric parameters and geometric parameters, is presented and taken into account as a fundamental role to the aim of optimizing the design of the Pierce gun. A cathode current value of 5…

010302 applied physicsBeam diameterMaterials sciencebusiness.industryTraveling-wave tubeSettore ING-INF/01 - Elettronica01 natural sciencesCathodeElectronic Optical and Magnetic Materialslaw.inventionSettore ING-IND/31 - ElettrotecnicaOpticslawcontrol grid electron gun PPM focusing system sensitivity analysis shadow grid TWTMagnet0103 physical sciencesKa bandElectrical and Electronic EngineeringbusinessBeam (structure)VoltageElectron gunIEEE Transactions on Electron Devices
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct